2. (a) Consider Amino Acid Sequence 2. How is Amino Acid Sequence 2 different from Amino Acid Sequence 1? Amino Acid Sequence 2: H,N*-Methionine-Valine-Histidine-Leucine- Threonine-Proline-Valine-Glutamic Acid-CO0- (b) Write a potential mRNA sequence for Amino Acid sequence 2, using the same codons for any given amino acid if it is present in both sequences.
Q: UAA is a stop codon. Why does the UAA sequence in the segment of mRNA…
A: Stop codons do not specify any amino acid. When ribosome faces any stop codon, it stalls. When the…
Q: 3. (i) Referring to the genetic code (the codon usage table), what would be the amino acid sequence…
A: DNA(deoxyribonucleic acid) is a double-stranded helical genetic material containing thousands of…
Q: What MRNA sequence codes the tripeptide shown below (write code in direction of N-terminus to…
A: Peptides are present in all individuals which are living. Peptides play may functional roles in our…
Q: Below is the 5’–3’ strand of a double-stranded DNA molecule with the following nucleotide sequences:
A: This question is based on the functioning of mRNA expression.
Q: 1.) What do the first four letters represent in the polypeptide sequence of SARS-CoV-2 surface…
A: Since you have posted multiple questions, we will answer the first one for you. If you want a…
Q: 3. You have assembled a very short contig below, but you don’t know if this is the sense or…
A: Gene is the segment of DNA (deoxyribonucleic acid) that is responsible for heredity and inheritance…
Q: 7. How many different mRNAs could specify the amino acid sequence met-phe-ser-pro? 8. Agene contains…
A: Ans 7: Genetic codes are triplet in nature. Genetic codons are degenerate in nature, which means,…
Q: 2a) Suppose you have a gene in which a single base substitution has created the nonsense mutation…
A: DNA(deoxyribonucleic acid) is the genetic material in all the organisms except few viruses. The…
Q: if a protein that contain the two codon sequences showed a molar mass of 97,313 g /mol and the UV…
A: The molecular weight of a Protein can be accurately predicted if the amino acids making up the…
Q: 1.List three different mRNA sequences that could encode the amino acid sequence…
A: DNA contains the information of the genes that code for a peptide or protein. A DNA gene sequence is…
Q: 1. Given is the 30 nucleotides in the human gene for hemoglobin (the oxygen-carrying protein in the…
A: The transcription is the process in which the mRNA copied information from DNA for protein…
Q: 1- Write the mature mRNA for both sequences, indicating both the 5' and 3' ends. Use the diagram…
A: 1. mRNA Sequence for Wild type Hemoglobin: 5' UACUAAUCGA AAAUUGCAGA CUGUAAUGGA CUGUAAUGGU GCACCUGACU…
Q: 3. A missense mutation results in the presence of a different amino acid than was encoded by the…
A: Sickle cell anaemia is an autosomal recessive disorder.
Q: All of the following occur when the amino acids of two tRNA molecules are joined, except. a. The…
A: DNA replication, transcription, and translation are the molecular processes that are responsible for…
Q: 4. a. A polypeptide contains 36 amino acids. How many nucleotides should be found in the open…
A: Codons are triplets of nucleotides, which codes for specific amino acids. The open reading frame is…
Q: 1. What would be the amino acid sequence encoded by the MRNA 5'CCAUGACGUCGGAUCAAUGAGC 3' 2. If the…
A: DNA replication is the process in whichbbhvgvhghhccvfgcbgvh
Q: 4. A hypothetical protein has a molar mass of 23,300 Da. Assume that the average molar mass of an…
A: Ans- a.) Molar mass of protein = 23,300 Da Average molar mass of amino acid = 120 Da # Therefore…
Q: 1. Using the table of the genetic code, determine the sequence of amino acids. 2. If mutation occurs…
A: Codons are triplets of nucleotides in the mRNA sequence, which is read by the ribosomes in order to…
Q: 8. A peptide hormone consists of nine amino acids in this sequence: arg-pro-pro-gly-phe-…
A: In this question, we are given a peptide sequence which is arg-pro-pro-gly-phe-ser-pro-phe-arg. We…
Q: Shown below is a portion of a DNA sequence ( 31 base pairs long ) that encodes the last amino acids…
A: The process of synthesis of messenger RNA with the help of template DNA strand is called…
Q: 1. DNA: 3’ TACAGTCTGTAGCGTACATTATCGTGACCGACT 5’ mRNA: polypeptide chain:
A: (According to our regulations, we are required to answer only the first question in case of multiple…
Q: 7. Draw a tRNA that would recognize the codon 5' A U G 3'. What is the sequence of this tRNA's…
A: As per the guidelines we are supposed to answer only the first question in case of multiple question…
Q: 1. Considering the following nucleotide sequence in an mRNA molecule: 5’ AUG UUA CGU AAU GCU GUC…
A: The genetic code is a set of three-letter combinations of nucleotides that corresponds to a specific…
Q: List three different mRNA sequences that could encode the amino acid sequence…
A: Since you have asked multiple questions, we will solve the first question for you. If you want any…
Q: 1. Given the anticodon in tRNA is CUU, name the amino acid that will be added. 2. Given the…
A: Since it is a multipart question we are supposed to answer only the first three questions as per the…
Q: Use the info of this molecule as well as the attached addendum to demonstrate the flow of genetic…
A: DISCLAIMER: Since you have asked multiple questions, we have solved the first question for you. If…
Q: 5. There is more than one codon and tRNA for most amino acids. The L-shaped molecule binds a…
A: Charged tRNA match an mRNA codon with the amino acid it codes. tRNA brings amino acids to…
Q: 1. Given the mRNA: 5'AUGCAUGACGAUCUCGUCGCG...3' a. Use the genetic code to predict the amino acid…
A: Introduction: A genetic code is a dictionary that corresponds with the sequence of nucleotides and…
Q: 4. A protein is found with the sequence Met-Thr-Tp-Phe-Lys-Cys-Arg-His-Pro-Gly, A mutant is found…
A: Mutations are change in the nucleotide sequence which results in abnormalities in the protein…
Q: Assume the first nucleotide in the sequence is at the +1 position. Transcribe the DNA sequence into…
A: ANSWER;-
Q: A life-form from another universe is found to have nucleic acid which includes six different bases -…
A: Disclaimer: “Since you have asked multiple questions, we will solve the first question for you. If…
Q: Your labmate gives you a gene with the following sequence of the coding strand for the first 5 amino…
A: given DNA strand first form the complimentary starnd by changing A - T and G-C for the strand 3' to…
Q: 25. A portion of an mRNA attached to a ribosome reads: 5′ GACAUGAACAGC 3′ If a tRNA with a…
A: The translation is a process of Protein synthesis where a copy of mRNA is used as a template strand.…
Q: 2. Consider the pre-mRNA molecule shown below. Re-order the events listed, in the sequence they…
A: Introduction : Through transcription process RNA synthesized from DNA. After that RNA processing…
Q: There are 61 mRNA codons that specify an amino acid, but only 45 tRNAs. This is best explained by…
A: Answer: Introduction: The mRNA codons are read while translation, starting with a start codon and…
Q: 17) Codons are three-base sequences in mRNA that specify the addition of a single amino acid to the…
A: 17) Correct answer is option d(codon are a nearly universal language among all organisms) because…
Q: Q. Deletion of a single AT base pair from codon number 4 can cause a frameshift mutation in a…
A: The DNA is transcribed into to an RNA by the process of transcription. Following the transcription…
Q: TGTACACATGTCCGAAACAGACTTACCGAA-5
A: For the given DNA Sequence , the translated mRNA is as follows_ 3'TGTACACATGTCCGAAACAGACTTACCGAA5'…
Q: The genetic information contained in DNA consists of a linear sequence of coding units known as…
A: From the given case, it is known that the E. coli DNA has a size of 4.70 X 106 bps. As, it is given…
Q: Shown below is a schematic drawing of a gene, with the transcription unit divided into numbered…
A: In the given diagram of splice donor site and acceptor site: - Splicing take place when a group of…
Q: 5' - ATGGCGAGGCGGCAGCTGTTATGGTGA – 3' In the sequence above, suppose that the 20th nucleotide of the…
A: The mRNA is produced from the template strand that is oriented in 3' to 5' direction and the newly…
Q: 5' ACTGAGGATTCGGACAGCAATAGGATG 3' When translated, the -1 reading frame of the sequence above gives…
A: The mRNA codon chart is used to find the amino acid with respect to the particular codon.
Q: Consider this nucleotide sequence of DNA strand in the image provided. If this strand is the sense…
A:
Q: 2. A reversion is a mutation that returns a mutant codon back to a codon that gives a wild-type…
A: Reversion mutation is one that causes such a change in the gene that does not cause change in…
Q: Why can introns be of any length?
A: Hey, since there are multiple questions posted, we will answer first question. If you want any…
Q: Fill in the blanks: The Lys60 (encoded by 5'-AAG-3' codon) of a protein is critical for its binding…
A: The ribonucleic acid or RNA is produced from these DNA by transcription process. Different types of…
Q: Below is the sequence from the 3' end of an mRNA. S'..CCGUUACCAGGCCUCAUUAUUGGUAACGGAAAAAAAAAAAAAA-3'…
A: The eukaryotic premature mRNA is synthesized without the poly-A tail. The poly-A tail is added at…
Q: 1) what is the net charge of the amino acid leucine of it is on the C-terminus end and why? 2) if…
A: Proteins are among the most numerous organic molecules in biological systems, and their structure…
Q: )Which of the following statements are true? Choose all that apply a)There are multiple codons…
A: The DNA expression involves the protein synthesis which involves a series of events primarily the…
Trending now
This is a popular solution!
Step by step
Solved in 2 steps with 2 images
- Exploring the Structure of the 30S Ribosomal Subunit Go to www.pdh.org and bring up PDB file 1GIX, which shows the 30S ribosomal subunit, the three tRNAs, and mRNA. In the box on the right titled ‘Biological Assembly.� click “More Images.� and then scroll down to look at the Interactive Vic By moving your cursor over the image, you can rotate it to view it from any perspective. a. How are the ribosomal proteins represented in the image? b. How is the 16S rRNA portrayed? c. Rotate the image to see how the tRNAs stick out from the structure. Which end of the tRNA is sticking out? d. Where will these ends of the tRNAs lie when the 50S subunit binds to this complex?Analyzing mRNA Sequences 1. Analyze the following amino acid sequence and write down a potential mRNA sequence from which this sequence might have been translated. Use the codon table in your book to determine a possible mRNA sequence. Amino Acid Sequence 1: H,N*-Methionine-Valine-Histidine-Leucine- Threonine-Proline-Glutamic Acid-Glutamic Acid- COO 2. (a) Consider Amino Acid Sequence 2. How is Amino Acid Sequence 2 different from Amino Acid Sequence 1? Amino Acid Sequence 2: H,N*-Methionine-Valine-Histidine-Leucine- Threonine-Proline-Valine-Glutamic Acid-CO (b) Write a potential mRNA sequence for Amino Acid sequence 2, using the same codons for any given amino acid if it is present in both sequences.Translation. Write the anti-codon sequence of the MRNA transcript. Translate the MRNA transcript into peptide sequence using both the 3 letter abbreviation and 1 letter abbreviation. ANTI-CODON 3' 5' SEQUENCE AMINO ACID N- C- SEQUENCE (3 letter terminus Abbreviation) Terminus AMINO ACID N- C- SEQUENCE (1 letter terminus Abbreviation) Terminus
- AAAGAGAAAAGAAUA to AAAGAGAAAUGAAUA. Suppose the codon sequence has a single base pair mutation If the old protein sequence was Lys-Glu-Lys-Arg-Ile, what will be the new sequence encoded by the mutant gene? (Use the 3-letter amino acid abbreviations with hyphens and no spaces in between, i.e. Ser-Asn-Tyr-Leu-Pro.) Submit Answer Retry Entire Group No more group attempts remainBe sure to answer all parts. Write a possible mRNA sequence that codes for each peptide. a. His-Cys-Tyr-Val-Ser 5¹- b. Phe-Val-Thr-Tyr-Glu 5'- 5'- c. Trp-Phe-Asn-Gln -3' U -3' с Table 26.2 The Genetic Code-Triplets in Messenger RNA First Base (5' end) -3' U UUU UUC UUA UUG CUU CUC CUA CUG AUL Phe Phe Leu Leu Leu Leu Leu Leu la C UCU UCC UCA UCG CCU CCC CCA CCG Second Base A UAU UAC UAA UAG CAU CAC CAA CAG Ser Ser Ser Ser Pro Pro Pro Pro Tyr 55 Tyr Stop Stop His His Gin Gin G UGU UGC UGA UGG CGU CGC CGA CGG Cys Cys Stop Trp Arg Arg Arg Arg Third Base (3¹ ond) DUAC DU AG с А АMRNA CODONS RESPONSIBLE FOR LINING UP EACH OF THE 20 AMINO ACIDS Amino Acid Code-End of the MRNA Codons* (anticodon) tRNA Alanine GCU Arginine Asparagine Aspartic Acid Cysteine Glutamic Acid AGA AAU GAU UGU GAA Glutamine CAA Glycine Histidine GGU CAU Isoleucine AUU Leucine CUU Lysine Methionine AAA AUG Phenylalanine Proline UUU CCU Serine UCU Threonine ACU Tryptophan Tyrosine Valine UGG UAU GUA * There are 64 codons. Some amino acids have several mRNA codons. There is, however, no overlap of codes. 1. You should be able to fill in the 3-letter "code-end" of the tRNA molecules in the table above. Remember, in RNA A pairs with U, and G pairs with C. There is no thymine. Fill in the table.
- MRNA CODONS RESPONSIBLE FOR LINING UP EACH OF THE 20 AMINO ACIDS Code-End of the Amino Acid MRNA Codons* (anticodon) tRNA Alanine GCU AGA Arginine Asparagine Aspartic Acid Cysteine Glutamic Acid Glutamine Glycine Histidine AAU GAU UGU GAA CAA GGU CAU AUU CUU AAA AUG Isoleucine Leucine Lysine Methionine UUU Phenylalanine Proline CCU UCU Serine ACU UGG Threonine Tryptophan Tyrosine Valine UAU GUA There are 64 codons. Some amino acids have several mRNA codor There is, however, no overlap of codes.Original sequence: Consider the following coding 71 nucleotide DNA template sequence (It does not contain a translational start): 5’-GTTTCCCCTATGCTTCATCACGAGGGCACTGACATGTGTAAACGAAATTCCAACCTGAGCGGCGT GTTGAG-3’ Question: 4) In a mutant you discovered that the underlined nucleotide has been deleted. What would the resulting peptide sequence be? What type of mutation is this? 5’-GTTTCCCCTATGCTTCATCACGAGGGCACTGACATGTGTAAACGAAATTCCAACCTGAGCGGCGT GTTGAG-3Determining the amino acid sequence in a protein usually in- volves treating the protein with various reagents that break up the protein into smaller fragments that can be individually sequenced. Treating a particular 11-amino acid polypeptide with one reagent produced the fragments: Ala-Leu-Phe-Gly-Asn-Lys Trp-Glu-Cys Gly-Arg Treating the same polypeptide with a different reagent pro- duced the fragments: Glu-Cys Gly-Asn-Lys-Trp Gly-Arg-Ala-Leu-Phe What is the amino acid sequence of the polypeptide?
- The full amino acid sequence of FABP6 is MAFTGKFEMECEKNYDEFMKLLGISSDVIEKARNFKIVTEVQQDGQDF TWSQHYSGGHTMTNKFTVGKECNIQTMGGKTFKATVQMEGGKLVVN FPNYHQTSEIVGDKLVEVSTIGGVTYERVSKRLA For the next step in your analysis, you ran a BLAST search of the PDB of this sequence and found a structure that is 59% identical to the sequence of your protein. The following is the alignment of two sequences (with your protein in blue (FABP6) and the homologous structure in red (3ELX)): Expect score = : 4 × 10−4² and Identities = 69/116(50%), Positives = 88/116(75%) 3ELX: 5 AFNGKWETECQEGYEPFCKLIGIPDDVIAKGRDFKLVTEIVQNGDDFTWTQYYPNNHVMT 64 AF GK + E EC++ Y+ F KL GI DVI K R+FK+VTE+ Q+G DFTW+Q+Y FABP6: 2 AFTGKFEMECEKNYDEFMKLLGISSDVIEKARNFKIVTEVQQDGQDFTWSQHYSGGHTMT 61 3ELX: 65 NKF IVGKECDMETVGGKKFKG IVSMEGGKLT IS FPKYQQTTEISGGKLVETSTASG 120 NKF VGKEC+++T+GGK FK V MEGGKL ++FP Y QT+EI G KLVE ST G FABP6: 62 NKFTVGKECNIQTMGGKTFKATVQMEGGKLVVNFPNYHQTSEIVGDKLVEVSTIGG H MT 117 The identical amino acids are shown in black…10. A portion of 5'-AUGCCACGAGUUGAC-3'. What amino acid sequence does this code for? To answer the question please: I) explain what is the genetic code and list the properties of the genetic e 2) draw a diagram of protein synthesis; 3) determine which tRNA should be attached to the mRNA; 4) what is the anticodon for the very first tRNA that will attach to mRNA? mRNA molecule has the sequence anQuestion 8 Review translation. Match the term and its description. Each term can only be used once. This site holds the tRNA that carries the growing polypeptide chain | Choose ) This site holds the tRNA that carries the next amino acid to be | Choose J added to the chain This site is the exit site, where discharged tRNAS leave the [ Choose ) ribosome Initiation, elongation and termination | Choose J >