(AKS 8a2, DOK 2) If this gel represents several different speices of birds, which two birds would be more closely related? Samples A B D E F Band # 1 4 二ニ三 10 A. A and E B. B and C || 23
Q: The result of crossing patchwork scale fish(F^B F^R.Use punnett square to identify.What % of A.)fish…
A: Punnett squares can be used to identify the possible genotypes as well as phenotypes of the…
Q: Dichotomous Keys – Use the dichotomous key to identify the following birds, Bird A Bird C A Key to…
A: A dichotomous key is a tool that allows the user to determine the identity of items in the natural…
Q: [S] Vo vo with I 0.00 0.00 0.00 1. 15 2. 14 0. 60 0. 25 0. 50 1. 15 2. 14 3. 75 6. 00 8. 57 1.00…
A: The plot is given in step 2
Q: Examine the diagram to the right to complete the following questions. 9. Which letter (a, b, s or d)…
A: Since you've got asked multiple questions, we are going to solve the primary question for you. If…
Q: Which of these pairs is incorrectly matched?a. H. erectus—made toolsb. H. rudolfensis—ate meatc. H.…
A: Homo erectus is extinct species of the archaic human from pleistocene with its occurrence over two…
Q: Postulate reasons as to why some bands are higher in intensity (thicker) than others for sample in…
A: Introduction: Gel electrophoresis is a technique that is commonly used to separate proteins based…
Q: A. cultural B. physiological / acclimatization C. developmental D. ge a tan. building a fire.…
A: Acclimatization is a physiological process by which our body can adapt to the changing environmental…
Q: II. B. Directions: Write an analogy for each picture. Make sure to use analogy to describe and…
A: The picture demonstrated in the above question depicts the consequences of the deadliest disease.…
Q: 11 12. 13.
A: Hypogynous flower- This tye of flower is said to have inferior ovary that is all plant parts arise…
Q: You test cross this polar bear, where D = drinks water, d = drinks Coke. N = likes to live at the…
A: Recombination is the process of formation of new recombinant chromosome by combining the genetic…
Q: Estimate the surface area of an adult human's head. Multipie Choice 05 m2 0.1 m2 10 m2 0.01 m
A: In humans, the head is at the top of the body and supports face and is maintained by the skull which…
Q: Experiment on The Predator-prey Interactions Between Zebrafish and Daphnia 1. Six 1-L beakers were…
A: A small planktonic crustacean is the Daphnia, these are the prey for the predators-zebrafish.
Q: rue or False. A t-test compares the standard deviation between two groups.
A: To find: Whether, the given statement is true or false
Q: nd giant pandas are not each oth innt nar hro urcidc
A: 2 ) option c is correct answer positive frequency dependent..
Q: cross ction belongs to a a monoco O True O False
A: In the cross-section of a monocot stem, the vascular bundles are arranged in a scattered pattern…
Q: 34 The table Ilsts the characteristics of four types of anlmals, Omall mammal; body that is about 32…
A: An ecosystem is defined as a community of living organisms in association with the nonliving…
Q: A calico or tortoise shell coloring in cats results from ?
A: Tortoises shell cats are named for their bi colored coats that looks like the shell of…
Q: The animal which original problem that Fibonacci investigated was about how fast it could breed in…
A: Leonardo Pisano Fibonacci was an Italian numerical theorist. He exposed the universe to a wide range…
Q: d. Slow maturation. 22. 1000 red and 1000 white ground beetles are placed on red clay in one cage…
A: Beetle They belong to the group of insects of order cleopatra.
Q: Near Point (cm) and Age Correlation 90 80 70 60 50 40 30 20 10 10 20 30 40 50 60 Age (years) What…
A: The point which is the closest distance where an object can be placed within the accommodation range…
Q: In the Latin name Canis lupis , the "Canis" is the name of the corresponding: a. Species c. Genus 1.…
A: “Since you have asked multiple question, we will solve the first question for you. If you want any…
Q: Individuals within the same species have the different DNA "fingerprint," but individuals from…
A: STR regions are used in DNA profiling. DNA profiling is a technique that forensic scientists use to…
Q: UESTIONS If there are 12 rock pocket mice wi
A: Hardy -Weinberg principle states that the population's genotype frequencies will remain constant…
Q: eg. Skin coloration in snakes OBb x OoBb 9/16 O_B_ 3/16 O_bb 3/16 ooB_ 1/16 oobb
A: In Snakes there are two genes that affect the coloration of the skin. One responsible for imparting…
Q: Percent change in egg mass 2 1 0 -1 -2 -3 0.00 Change in egg mass over time 20.00 Time (min) 40.00…
A: Osmosis is the phenomenon of the transfer of water across a semipermeable membrane. The flow of…
Q: The ___________________ of an egg serves as an embryos water supply while the ____________ provides…
A: The correct option is C) albumen; allantois
Q: Weighing gold fish prior to conducting experiments on them is done ...
A: Introduction Metabolism is the process by which living organisms obtain energy to drive their…
Q: Body weight and length were measured on six mosquito fish; these measurements are given in the…
A: A correlation coefficient is a statistical relationship between two variables. The statistical…
Q: 8. Why are the wings of birds and flies analogous structures? sc.7.L.15.2 alqxa A They perform a…
A: A wing is defined as a type of fin that will produce lift while moving through or via the air or…
Q: Can COVID-19 last on snow
A: Covid-19 is a respiratory system based illness caused by the coronavirus. In the late stage of the…
Q: In the case where you face a large landscape which includes a pine forest along with oak and shrub…
A: introduction A sample is a subset of people from a bigger population. Sampling means selecting the…
Q: Zoology experiment: The Predator-prey Interactions Between Zebrafish and Daphnia 1. Six 1-L beakers…
A:
Q: Freq of AA Freq of Aa Freq of aa Freq of A (p) Freq of a (q) Generation 1 20 1 0.5 0.5 (from above)…
A: Hardy-Weinberg principle states that in a population, the allelic frequency of all the gene pool is…
Q: Which of the patterns below is not an MII pattern? A в с D
A: In some fungi, product of meiosis is four spores or eight spores.
Q: about HARRIS Boric Acid Roach and Silverfish Killer Powder.
A: HARRIS Boric Acid Roach and Silverfish Killer Powder is use for killing insects
Q: COVID-19 affected the mobility of people
A: Coronavirus disease (COVID-19) is a type of infectious disease that is caused by a newly identified…
Q: If you noticed on most descriptions of species, the measurement of a particular body part has a…
A: The measurement of a particular body part has range.
Q: Make a dichotomous key for Aye aye Human Pig Giant bear Koala
A: Among the organisms, the koala is a marsupial while the remaining animals are placental mammals.…
Q: How many F, Guinea pigs may have black eyes an How many F, Guinea pigs may have red eyes and smooth…
A: Since you have posted a question with multi- sub parts , we will solve first three sub-parts for…
Q: Three minutes after birth, a newborn has an Apgar score of 5 asfollows: A, 0; P, 1; G, 1; A, 1; and…
A: APGAR test is normally done within 1to 5 minutes after the baby is born. It is scored from 0 to 2.…
Q: Write a note on ... a)blood cells b)theories of evolution c)Gene expression
A: We are answering 3 parts for rest of it pls repost
Q: (a) CH3 CH3 (b) CH, HC=CCCH3 CH3CHC=CCHCH3 ČH3 (c) CH3 (d) CH3 CH3 CH3CH2CC=CCH,CH2CH3…
A: IUPAC nomenclature is a set of rules that is formed and used to name the organic molecules. By the…
Q: ii) The actual data is shown below. Does this ratio match your expectations If not, explain why…
A: Chi square test is used to determine whether there are found significant difference between observed…
Q: You test cross this polar bear, where D = drinks water, d = drinks Coke. N = likes to live at the…
A: The polar bear has three contrasting traits namely : 1) Drinking habit - It has two alleles. One is…
Q: Tima in minutac X273 00, V3 56 1 106 X90.50, Y.1.35 105 10 10 105 X:30.50, Y:6.73 104 10 104 104 10…
A: Generation time: Generation time is the time required by any cell population to double its number,…
Q: In a herd of long horn cattle the mean horn length is 52cm and h2 is 0.2cm. Predict the mean horn…
A: Cattle can be defined as the type of domestic animal which is raised for the production of milk, and…
Q: Individuals within the same species have the different DNA "fingerprint," but individuals from…
A: DNA fingerprinting is a routinely used technique in molecular biology and biotechnology laboratories…
Q: Shin as they exist ivs bod 5. Barnacles are small sea creatures which filter plankton and other…
A: Interaction between organisms are chiefly divided into the following classes: Positive interaction;…
Q: Graph 1 and 2 are similar because... 1. 2. 3. Graph 1 and 2 are differe t because.. 1. 2. 3. USE THE…
A: INTRODUCTION Regulation of blood glucose in the body is done by endocrine hormones produced by…
Step by step
Solved in 2 steps
- b. BbRr x bbrr BR Br bR br BbRr Bbrr br BBRV Bbr ber bbor br How many F, Guinea pigs may have black eyes and rough fur?. How many F, Guinea pigs may have red eyes and smooth fur?. How many F, Guinea pigs may have red eyes and rough fur?. How many F, Guinea pigs may have black eyes and smooth fur? How many F, Guinea pigs may be homozygous for both genes? How many F, Guinea pigs may be heterozygous for both genes? ell'ca unctic restir chon GOgive answer for 13 and 14 with explanation asap dont copyEdio | Calendar X Edio | Student Da x days/1089977/lessons/1533969/variants/2439102/take/10/ A Q TEXT ANSWER The inheritance patterns for some traits in guinea pigs are listed in the table below. 1. Identify the phenotype of a guinea pig with the genotype HhBBrr. 2. Using the allele symbols in the table, identify the genotype of a guinea pig that is recessive for hair length, heterozygous for hair color, and homozygous dominant for hair texture. Trait Dominant Allele Recessive Allele hair short (H) long (h) length hair color black (B) white (b) rough (R) smooth (r) hair texture BIUG X₁ X¹ EEAA H Normal : √x Enter your answer here ŏooooo Questions Answered 中山川 Ω Ο Τ Edio | Calendar X RepostExchange X Practice All Changes Saved Continue
- may I ask how you get 12-65 of the leptin's size?edity /7 of 22 The hydra is a very small, simple animal that lives in water. During reproduction, a bud breaks off an adult hydra and floats away. 1 - 3. Which of the following describes a hydra bud? O A. A hydra bud has half as much genetic material as the parent hydra. O . hydra bud is genetically identical to the parent hydra. O C. A hydra bud contains genetic material from its two parents. O D. A hydra bud has different mutations than the parent hydra.Search the menus (Alt+/) A, ? 75% Normal text Calibri BI U A 11 + 1 | 2 6 9. Ishta, a female Yuan-ti, met Hisssteth, a male Yuan-ti, during sword training. He admired how quickly she moved using her powerful legs. She, in turn, was drawn to his skill as a sword fighter, using his tail ( for which she is homozygous) to slither about quietly with his weapon. Create a Punnett Square to show the possibilities that could result if Ishta and Hisssteth were to mate together and lay a clutch of eggs. Alleles (letters) and All Genotype and Phenotype Parent Punnett Square Phenotypes Possibilities Genotypes Genotype Phenotype Phenotype 9 of 17 Mom a. What is the probability of having a tailed baby? What is the probability of having a baby with legs?
- give answer for 8 and 9 asap dont copyCH 1-4 X ← → C Maya X Credibi X app.wizer.me/learn/00E0A8 wizer.TIE a Maya S x BW x BW To-do X Assign x b M Dashb X BB x BW Figura X Figurat X A chicken breeder has chickens that are white, black, or speckled. Speckled chickens have both black and white feathers. The allele for white feathers is (W). The allele for black feathers is (B). Determine the genotypes of the rooster and hen that would breed the greatest percentage of speckled chickens. BW x WW Dashboard Incomp X Interac X STILCI GIESS LUUC BB x WW + with white (W). The heterozygous phenotype is brown and white V < ☆ GO(ii) Is the sequence below in FASTA format? Justify your answer. >gi 129295|sp|P01013 | OVAX_CHICK GENE X PROTEIN (OVALBUMIN-RELATED) QIKDLLVSSSTDLDTTLVLVNAIYFKGMWKTAFNAEDTREMPFHVTKQESKPVQMMCMNNSFNVATLPAE KMKILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQMKIEEKYNLTS VLMALGMTDLFIPSANLTGISSAESLKISQAVHGAFMELSEDGIEMAGSTGVIEDIKHSPESEQFRADHP FLFLIKHNPTNTIVYFGRYWSP Chymotrypsin elastase trypsin plasminogen factorXI transmembrane consensus Chymotrypsin elastase trypsin plasminogen factorXI transmembrane consensus (iv) Based on Figure 4, state which software could assist in generating these results? 1 FHFCGGSLISEDWVVTAA CGVRT-----SDVVVAGEFDQGSDEENIQVLKIAKVFKNPKFS--ILTVNNDITELKLATP 1 YHTCGGSLIANSWVLTAAHCISSSR----TYRVGLGRHNLYVAESGSLAVSVSKIVVHKDWNSNQIKSGNDIALLKLANP 1 YHFCGGSLINEOWWVSAGHCYKSR------IQVRLGEHNIEVLEGNEQFINAAKIIRHPOYD--RKTLNNDIMLIKLSSR 1 MHFCGGTLISPEWVLTAAHCLEKSPRPS-SYKVILGAHQEVNLEPHVQEIEVSRLFLEPTRK----- 1…
- I Review Lesch-Nyhan syndrome (OMIM 300322) is a rare X-linked recessive disorder that produces severe mental retardation, spastic cerebral palsy, and self- mutilation. Part A What is the probability that the first son of a woman whose brother has Lesch-Nyhan syndrome will be affected? Express your answer as a fraction (example 1/16). Submit Request Answer Part B If the first son of the woman described in (a) is affected, what is the probability that her second son is affected? Express your answer as a fraction (example 1/16). Submit Request Answerd/e/1FAIPQLSCDH_No2]MEaHUdrt5NWa2uY6AaKa7Bhy4xfhwplF-CsVAbyA/formResponse M Gmail YouTube O Maps Which phrase best describes a human with the chromosomes represented in the karyotype below? * 1 3 4 5 X r8 K* XX从 6. 8 9. 10 X* ** ** 11 12 13 14 15 16 17 18 19 20 XX 44 21 22 XX O A female who exhibits Down syndrome A male who exhibits Down syndrome O A female who does not exhibit Down syndrome O A male who does not exhibit Down syndrome 8.IV 0000 In the accompanying figure, determine the possible genotype(s) of IV-8. 23 2 3 AA or Aa AA only Aa only aa only Cannot be determined N 3 5 6 7 8 9 7 TO 11 10