Beta sheets shown in the figure below are: "" Parallel Not enough information One strand is parallel and another is anti-parallel Anti-parallel
Q: Consider the second titration. PH 14.0 12.0 10.0 8.0 10 11 7 4 1 9 6.0 4.0 2.0 0.0 0.5 1.0 1.5 2.0…
A: Titration is used for determining the amount of acid in a solution. Sodium hydroxide is added to a…
Q: You are working at a major pharmaceutical company, and you have purified an engineered enzyme, and…
A: To determine the protein stability (ΔG in kJ/mol) using the provided equilibrium unfolding data, you…
Q: For a particular reaction, AH = -16.1 kJ/mol and AS° = −21.8 J/(mol·K). Assuming these values change…
A: To determine the temperature at which the reaction changes from nonspontaneous to spontaneous in the…
Q: A lysine is on the surface of a protein near an arginine, how does this alter pKa of lysine
A: The pKa of an amino acid's side chain determines whether it is protonated (+) or deprotonated (-)…
Q: Proteins have a variety of roles. Which role is shared with elaborately folded RNA? Being structural…
A: Proteins are biomolecules that serve diverse functional roles within a cell. Proteins that catalyse…
Q: This image shows the tertiary structure of a protein segment. Tertiary structure results from…
A: Ionic bond is formed between a positively charged and a negatively charged group. The charged groups…
Q: Which of the following define the stereochemistry of alanine (as per the structure shown)? Note:…
A: Amino acids are biomolecules that are comprised of two functional groups, these are an amino group…
Q: From a kinetics experiment, kcat was determined to be 295sec-1. For the kinetic assay, 0.3mL of a…
A: Let the initial concentration of the enzyme in the reaction mixture be E0E0 = (Volume of enzyme…
Q: You will now build a 15 amino acid peptide using another paper or wire backbone as you did above.…
A: Peptides are polymers of amino acids. Proteins are primarily peptides. There are 20 general…
Q: A C R > N-H R O X₂ X² Ω· R ©Ð»>«< N-H C=O--HOR (N-H R R E R Type your answers in all of the blanks…
A: A hydrogen bond is a non-covalent, relatively weak, chemical bond in which a hydrogen atom…
Q: 1. Which of the following best describes the relationship between a reactant molecule and an enzyme?…
A: Enzymes are biological catalysts made of proteins. Biochemical processes require enzyme catalyzed…
Q: Determine whether each of the examples or phrases describes an essential amino acid, a nonessential…
A: Amino acids are biomolecules that have an amino group and a carboxyl group linked to the same carbon…
Q: Glycine Alanine Valine Leucine Isoleucine Name Structure 1-Let Abbr 3-Let Abbr Class (non-polar,…
A: Amino acids are organic compounds that form the building blocks of proteins in cells. The structure…
Q: +40mV -70mV 2 3₂ OmV 4 ich concet Resting Potential 2 froar points to the dupy Time…
A: Electrical signals are how neurons communicate. Electrical signals are generated when there is a…
Q: Classify each of the following fatty acids as saturated, monounsaturated, or polyunsaturated.…
A: • Saturated fatty acids: saturated fatty acids are fatty acids that contain only single covalent…
Q: lace the description with the appropriate step in the enzymatic reaction.
A: Enzymes act as biological catalysts by speeding up the rate of chemical reactions. Enzymes act upon…
Q: You have not correctly determined what fraction of estrogen receptors is expected to be free in the…
A: Fractional saturation (Y) is the fraction of Receptors (R) that is bound by its Ligand (L). It can…
Q: Which of these amino acids is a basic amino acid? (Select all that apply, if necessary.) A. B. C. E.…
A: Amino acids are biomolecules that have an amino group and a carboxyl group linked to the same carbon…
Q: Please draw the structure of the 19 L-a-amino acids and proline in any form, as you prefer. You may…
A: Amino acids serve as monomers of proteins and composed of a carboxyl group, an amino group, a…
Q: Which class does the following enzyme belong to: GTP Hydrolases Lyases Ligases Transferases…
A: Enzymes are proteins that catalyze chemical reactions in living organisms. It is highly specific to…
Q: A receptor-ligand complex has a dissociation constant of Kd = 20 nM. The rate of receptor-ligand…
A: The dissociation constant (Kd) for a receptor-ligand complex is related to the rate constants for…
Q: In detail ,compare between alpha helices and beta sheets?
A: Proteins are the biomolecules that show great variation in their structural organisation. They are…
Q: Identify the predominant intermolecular forces in each of the given substances. Electrostatic…
A: Ionic interaction: it can be defined as the electrostatic interaction between oppositely charged…
Q: Recall from the central dogma that DNA codes for mRNA, which then codes for protein. Also recall…
A: As per the central dogma of molecular biology, the genetic information for protein synthesis is…
Q: Matching ◆ Another word for Gibbs Free Energy A. R Side Chain of Amino Acid with Positive charge B.…
A: Spontaneous reactions are those that do not require an input of energy to drive the reaction to…
Q: When C-2 is labeled, why does the label survive two full turns of the cycle but then become equally…
A: Oxaloacetate is a four-carbon compound, and carbon-2 (C-2) refers to the second carbon atom in the…
Q: 7:36 Done Instructions Imagine you are an exploratory astronaut looking for life throughout the…
A: From the analysis of the periodic table, it can be found that 'Silicon' has the potential to…
Q: The amino acid sequence of a small protein is MSRLASKNLIRSDHAGGLLQATYSAVSSIKNTMSFGAWSNAALNDSRDA.…
A: MHC (Major Histocompatibility Complex) are molecules responsible for presenting pathogenic peptides…
Q: Mixtures of amino acids can be analyzed by first separating the mixture into its components through…
A: At a pH of 7, the side chain of some of the amino acids will be positively charged, some will be…
Q: D The peptide KNYPEH N-terminal amino group has a pKa of 8.6 and the C-terminal carboxylate group…
A: A peptide is a short chain of amino acid residues linked together via a peptide bond. Amino acid…
Q: - Multiple choice 1. Which of the following choices is correct about the active site of an enzyme?…
A: The area of an enzyme where the substrate is bound is called the active site. It is created from…
Q: So which form of the arginine side chain is the ionized form? And when the side chain is ionized the…
A: Arginine is an amino acid with a side chain that contains a guanidine group. In its conjugate acid…
Q: 1: QAMGRAGDLKYLGLHSV Peptide 2: ALMALFMVMALVLVSVLFIA Peptide 3: MVEDLLKQIARYLISE (a) Circle all of…
A: We are authorized to provide three sub parts at a time; since you have not mentioned which part, we…
Q: The equilibrium constant of a system, K, can be related to the standard free energy change, AG,…
A: Details
Q: 7. Which of the following statements is true about enzyme-catalyzed reactions? a The reaction is…
A: The reaction which occurs in the presence of an enzyme is called enzyme catalysed reaction.Enzymes…
Q: Which of the following molecules is richest in energy when metabolized? Glucose Linolenate, a fatty…
A: Glucose is the primary source of energy for the body. When there is no glucose available, the body…
Q: You're examining an amino acid at position 3 in an alpha helix. Without knowing the specific amino…
A: Amino acids are the building blocks of proteins and play essential roles in various biological…
Q: What are the chromophores detected by circular dichroism (CD) spectroscopy of a protein? peptide…
A: Circular dichromism (CD) is exhibited by molecules that have a chiral centre. The CD is a reference…
Q: the atoms in the compound. F arbon has an atomic weight of atoms x 1 = 12) + Oxygon ha
A: Molecular Formula of Starch C 6 H 10 O6. The molecular weight of Starch is 162.(72+10+80) = 162.
Q: Why does a folded mutant protein aggregate rather than remain a misfolded monomer?
A: Proteins are essential molecules in biological systems, and their proper folding is crucial for…
Q: How do you account for the differences in the amounts of proteins, lipids, carbohydrates, and…
A: Understanding the complex balance of proteins, lipids, carbohydrates, and nucleic acids in a…
Q: 2. Estimate the pl of a Peptide. Estimate the pl for the following peptide: EHSLRGGA 3. Estimate the…
A: Recall that:Amino acid sequences are written with N-terminal amino acid on the left and C-terminal…
Q: What protein has the code 6JX7 in the protein data bank? protein A. membrane B. spike protein C.…
A: The Protein Data Bank (commonly referred to as PDB) is an open access database containing…
Q: ou have been researching two additional methyltransferase enzymes that catalyze the same reaction.…
A: For a one-substrate enzyme-catalyzed reaction, the Michaelis-Menton equation shows the quantitative…
Q: What is the net charge of cysteine in an aqueous solution at pH 9? Carboxyl group pKa = 1.92; Amino…
A: Cysteine is a polar but uncharged amino acid with thiol side group. The cysteine side group is…
Q: 6. A quantitative amino acid analysis reveals that bovine serum albumin (BSA) contains 0.58%…
A: Amino acids, such as glycine, tryptophan, and alanine are organic molecules that contain an amino…
Q: Part A CaO can be used as a drying agent. One such application occurs when water is added to dry…
A:
Q: How many possible dipeptides can be formed from the amino acids aspartic acid, glutamine,…
A: Amino acids are biomolecules that have a hydrogen, a carboxyl group, an amino group and a chemically…
Q: 9. Name the following compounds using R.S designations: 'CH, a. HO H H₂ C CH₂CH, CH₂OH B. HỌ-CH,…
A: R-S system - The R / S system is an important nomenclature system for denoting enantiomers. This…
Q: c) Draw a diagram of amylose in solution
A: Starch is a polysaccharide composed of glucose units joined by α-1,4 glycosidic bonds. It is the…
Trending now
This is a popular solution!
Step by step
Solved in 3 steps with 2 images
- 3’ TACAATGGGCGACGCGCTTCGTTTCAGATT 5’ 5’ ATGTTACCCGCTGCGCGAAGCAAAGTCTAA 3’ Make vertical lines between codons to make this assignment easier to do. Which strand is the template strand? The first strand is the template strand as it going 3-5 Copy the template strand in mRNA. Label the 5’ and 3’ ends. 5' AUG UUA CCC GCU GCG CGA AGC AAA GUC UAA 3” Write out the amino acid (you can use the short form) that this protein would be made of (keep in mind proteins are usually a minimum of 50 proteins. Met-Leu-Pro-Ala-Ala-Arg-Ser-Lys-Val What do you notice about the mRNA strand compared to the non template strand of DNA? 2. What amino acid does the second codon code for on the DNA template strand? ______Assume the 6th amino acid in the strand is changed from a T to a C. What amino acid does it code for now? _______ What type of mutation is this? 3. Assume the 6th amino acid is changed from T to G on the DNA template strand. What type of mutation is this? What effect would…Given DNA strand: 5' T G T T A G T C G A A T 3' Write its complementary DNA and its mRNA.40 Shown below is the antisense strand of DNA. What is the amino acid sequence that corresponds to this code? 5' AAAGCATACCGG 3' Second letter G. UUU Phe UCU UAU) Tyr UGC Cys UGU UUC UCC UAC Ser UAA Stop UGA Stop A UAG Stop UGG Trp UUA UCA UUG Leu UG CAU His CGU CGC CGA CGG CU CUU CUC CUA CUG CAC Pro Leu Arg CCA CAA) Gin CCG CAG AAU AUU AUC lle AUA AUG Met ACG ACU AGU AAC Asn AGC Ser ACC ACA Thr AAA1 AGA AAG Lys AGG Arg GAU) Asp GGC GAC Ala GAA GGU GUU GUC GUA Val GCU GCC Gly GCA GGA Select an answer and submit. For keyboard navigation, use the up/down arrow keys to select an answer. a PRO-VAL-SER-PHE PHE-ARG-MET-ALA GLY-HIS THR-LYS d LYS-ALA-TYR-ARG First letter Third letter
- Here is the nucleotide sequence of an imaginary strand of DNA: 5’ AATTGGCCATGC 3’. If this strand of DNA was transcribed, the resulting messenger mRNA molecule would be: Met-Val-Tyr-Lys 3’ TACGTACG 5’ 3’ TTAACCGGTACG 5’ 3’ UUAACCGGUACG 5’A DNA antisense strand contains the following nucleotide base sequence:CGA TTT GGT TGA How many amino acids does the mRNA strand above code for?DNA RNA AMINO SENSE strand ANTISENSE CODON ANTICODON ACID strand ATG TAC CAT GTA АCА TGT тCG AGC CC GCG GTC CAG AAG TTC TGC АCG ATC TAG TAG АТС
- Coding strand CGT CTC TTC GGA CAC whar is the mRna strandGive me nucleotide sequence with pairing. Like this ATC TCA TGA GCC TAG AGT ACT. CGG#3 HaelII --- 5’ CC ↓ GG 3’ 5’ ACGCCGGCCGTATTAT CCGGATCCGCCG CCGGCTGTCCCGGATCA 3’ 3’ TGCGGCCGGCATAATAGGCCTAGGCGGCGGCCGACAGGGCCTAGT 5’ Restriction enzyme: Recognition sequence: Number of pieces of DNA: Type of cut:
- Using the table of genetic code, choose the CORRECT protein sequence that will be produced from the following sense strand of DNA: 5'-AUG UCU GAC UAG TTG GAT CCC - 3' Second position First position (5' end) Third position (3' end) Phe Ser Tyr Cys U Phe Ser Тут Cys Leu Ser Stop Stop A. Leu Ser Stop Trp Leu Pro His Arg Leu Pro His Arg Leu Pro Gln Arg Leu Pro Gln Arg Ile Thr Asn Ser U Ile Thr Asn Ser Ile Thr Lys Arg A Met Thr Lys Arg Val Ala Asp Gly U Val Ala Asp Gly C Val Ala Glu Gly A Val Ala Glu Gly O a. Lys-His-Ala-Gly-Asn-Leu-Val O b. Val-Val-Ser-Pro-Leu-Asp-ThrGiven the following template DNA strand, what is the correct complementary DNA sequence? 3' CGC AGT GGA CAT TTC 5'#4 BamI --- 5’ CCTAG ↓G 3’ 5’ ACGCCTAGGACGTATTATCCTAGGTAT CCGCCGCCGT CATCA 3’ 3’ TGCGGATCCTGCATAATAGGATCCATAGGCGGCGGCAGTAGT 5’ Restriction enzyme: Recognition sequence: Number of pieces of DNA: Type of cut: