DNA Sequence Enter DNA sequence below Original sequence ATGCCAGGCGGCGAGAGCTTGCTAATTGGCTTATAG ATGCCAGGCGGCGAGAGCTTGCTAATTGGCTTATAG Edited sequence Apply Show DNA Transcribe Translate Show protein Continue one step Start/continue model Stop Reset
Q: What is Enterobacter aerogenes? What did Enterobacter aerogenes cause?
A: Enterobacter aerogenes is a rod shaped, gram-negative, pathogenic bacteria. It is also called…
Q: ewith a long tailed mouse. Multiple cresses of this short-tailed mouse to long-taled mice produces…
A: Answer given in step 2 . Please find the attachment. Please provide clear image in future. Thank…
Q: Compare and contrast the efficiency of the different organ systems and adaptations between…
A: 1.)Cnidarians are diversified animals than ctenophores. Cnidarians live in both freshwater and…
Q: 7. A nail driven into the side of a tree will remain at exactly the same distance from the ground…
A: Angiosperms: Flowering plants, also known as angiosperms, are plants that produce flowers and…
Q: What are the unifying characteristics of Gnathifera? Are these characteristics present in all…
A: Ahlrichs established the taxon Gnathifera based on morphological data. The Gnathostomulida and…
Q: What are the most important environmental challenges that plants face living on land?
A: An environment can be defined in biology as a collection of chemical, physical, biotic, and other…
Q: In the adaptive immune response which antigen are mount cellular responses? T helper lymphocytes T…
A: Answer
Q: The main products of the light dependent reactions are: O water and carbon dioxide ATP and NADPH O…
A: To determine: To determine the main products of the light dependent reactions
Q: 1. Which of the ff is NOT a form of asexual reproduction? A. Budding B. Fission C. Fragmentation D.…
A: Introduction :- In biology, budding is a type of asexual reproduction in which a new individual…
Q: Compare the auto induction media (AIM) with regular induced protein expression. Which is better when…
A: Most of the eukaryotic proteins are still produced via genetic engineering it into host prokaryotic…
Q: THE MOST COMMON METHODS OF BACTERIOLOGICAL RESEARCH AIR 1. slit 2. thermoprecipitation 3.…
A: Please follow step 2 for detailed explanation.
Q: To examine: whether the statement "protein tyrosine phosphatases display exquisite specificity for…
A: Protein phosphatases are the enzymes which are involved in controlling diverse array of processes in…
Q: A community-based intervention program for hypertension was undertaken in two communities to compare…
A: Given: Hypertension is a prominent risk factor that poses global burden of diseases. It is most…
Q: MECHANISMS EXAMPLES 1. 1. Geographical Isolation 3. 1. 2. 2. Temporal/Seasonal Isolation 1. 2. 3.…
A: Temporal isolation is when species that could interbreed do not because the different species breed…
Q: Circulatory System 1. Why are the ventricles more muscular than the atria? 2. What valve prevents…
A: CirculatorySystem: The heart, blood vessels, and blood are all part of the blood circulatory system,…
Q: Which of the following are characteristics of minerals? Select all answers that apply. Inorganic Not…
A: Introduction Minerals are necessary for your frame's well-being. Minerals are used by your body…
Q: 22.10 What causes acid rain? 22.11 How does acid rain damage trees? 22.12 How does acid rain damage…
A: Disclaimer: “Since you have posted a question with multiple sub-parts, we will solve the first three…
Q: How does the blood in the pulmocutaneous arch differ from that in the higher two aortic arches?
A: The circulatory system of amphibians includes pulmocutaneous circulation. It is in charge of…
Q: ewith a long tailed mouse. Multiple cresses of this short-tailed mouse to long-taled mice produces…
A: Genotype can be refer to a gene or set of genes that leads to a single trait or disease.
Q: ROSE OF WIND 1. graphic image of the frequency of wind direction in the area 2. wind speed, shown…
A: A wind rose is a graphical tool that meteorologists employ to show how wind speed and direction are…
Q: You have obtained the following pedigree chart I II III O IV O 1 2 Using the letters A or a or XA or…
A: Inheritance pattern is a pattern which determines how traits are passed from one generation to…
Q: What is the mode of inheritance shown in this pedigree? II 1 3. 6. 7. 2 3 5 6 7 8 9 10 IV 1 2 3 5 67…
A: Since they lack a second copy of the X chromosome to give a dominant allele, any XY individual who…
Q: What is the advantage of the countercurrent gas exchange in the case of some molluscs? Why is it not…
A: Counter current involves blood in the capillaries flowing in the opposite direction to the flow of…
Q: To explain: Which component does the KDEL receptor bind its ligand more tightly and more weakly.
A: Proteins are the fundamental building blocks of many biological structures, including cell…
Q: Was LUCA likely an RNA-based or DNA-based organism? Why?
A: Answer
Q: osmoregulation and Its Function in our Body
A: Osmoregulation is the procedure of maintaining salt and body fluids balance (osmotic balance) across…
Q: i need the answer quickly
A: Dust is of following types: - Visible Microscopic Ultra Microscopic Visible is filtered out at the…
Q: 4. WATER HAS THE PROPERTY OF ADHESION, WHICH ALLOWS IT TO USE WHICH PROCESS IN PLANT ROOTS? A:…
A: Ans is.. capillary action
Q: Which of the following statements about natural selection is not true? O Natural selection operates…
A: Natural selection is the process through which individuals with various phenotypes survive and…
Q: Describe the four membranes in the avian egg. How does EACH membrane affect the developing embryo?
A: Avian egg development.
Q: Give the major factors that cause changes in the genotype and allele frequencies of a population…
A: Evolutionary mechanisms do not operate in isolation in natural populations. Conservation…
Q: What is the mode of inheritance shown in this pedigree? O a. Autosomal dominant O b. Mitochondrial O…
A: This is example of autosomal recessive disease
Q: need help with microbiology/2010 1. Describe where the following items should be discarded: a)…
A: There are two types of bacteria: Gram-negative Gram-positive
Q: B. Cholesterol mainly occurs in the cell walls of mammalian cells
A:
Q: Label the structures of the lymphatic system in the accompanying figure. ch Lymphatic vessel…
A: Lymphatic system Lymph is a colourless fluid that contains the immunity cells or the white blood…
Q: To determine: How chloroplasts generate a larger proton gradient across the thylakoid membrane than…
A: For living functions, that is when it comes on to the term that the cell eukaryotic cells require a…
Q: Given the following information about the inheritance of characteristics in pea plants, answer the…
A: 1. Different gametes produced by the female plant= yyRrBbssll Using formula = 2n n= number of…
Q: explain the structure of skeletal muscle, linking the structure to their function as you do this.
A: A skeletal muscle is made up of hundreds or thousands of muscle fibers bundled together and encased…
Q: ANSWER THESE QUESTION; Click Edit DNA and make a substitution mutation that changes the first base…
A: Original sequence- ATG CCA GGC GGC GAG AGC TTG CTA ATT GGC TTA TAG Edited sequence- changes the…
Q: why doesn't nalidixic acid affect human cells
A: Quinolones are one of the most commonly prescribed classes of antibacterials in the world and are…
Q: The division of the autonomic nervous system that prepares the body for intense levels of activity…
A: Autonomic nervous system is the part of peripheral nervous system, that mostly controls the…
Q: In which of the following situations would you expect to probably see differences in the speed of th…
A: Molecular clocks monitor the changes or mutations that accumulate in various gene sequences between…
Q: what are 4 antagonistic interaction between two or more species that are exploited to improve…
A: Antagonist interaction between two species is the negative interaction where one species is…
Q: he final products of anaerobic glycolysis are Write your response here or Write your response here…
A:
Q: Male and female ruffed grouse look similar, except during courtship when the males raise their neck…
A: Ruffed Grouse are one of ten grouse species native to North America, and they are one of the…
Q: What are the characteristics common to all arthropods? List all of them.
A: Invertebrates are the organism belonging to animal kingdom which do not possess backbone . Such…
Q: 4. What are coenzymes?
A: Introduction :- Small compounds called coenzymes cannot catalyse reactions on their own, but they…
Q: Please i really need the right answer there is mutiple queshtions and i need the right answer and…
A: B is the correct answer. Multiple alleles occur when there are more than two possible alleles for a…
Q: In which of the following situations would you expect to probably see differences in the speed of…
A: ANSWER;- Comparison of nuclear and mitochondrial genes in the same species Explain;- The most…
Q: METHOD FOR OBJECTIVE EVALUATION OF NATURAL LIGHT 1. the angle of incidence 2. the opening angle 3.…
A: Natural Light: Sunlight is a subset of the Sun's electromagnetic energy, which includes infrared,…
please answer patiently
Step by step
Solved in 2 steps
- + Jimenez me O Lab Interac O (71) Alfie Ca G lab concord G quantum m b Success Cor a holodeck * Regression * Page missir G regression O Lab Inte x Ask Your ST + Lab Interac A Not secure | http://lab.concord.org/embeddable.html#interactives/sam/DNA-to-proteins/4-mutations.json Share About DNA Sequence Enter DNA sequence below Original sequence ATGCCAGGCGGCGAGAGCTTGCTAATTGGCTTATAG ATGCCAGGCGGCGAGAGCTTGCTAATTGGCTTATAG Edited sequence Apply Show DNA Transcribe Translate Show protein Continue one step Start/continue model Stop Reset The Concord Consortium 9:45 pm 12/05/2022 30°C ENG 4) O Partly cloudy US (7.A Meet - rfc-prp x A G-Unit 5: DNA an X 4 https://docs.goog x y google classroom xP Classes cs.google.com/forms/d/e/1FAlpQLSeyPC6Kmoa0k5JJd1DWGzqqRwaQQobHN0OdqFX_aDbV_6-bKw/formResponse x New Tab D YouTube Маps E Copy of Distance Le. Launch Meeting - . 2020 HORNETS 4N. O StudentVUE 2 Mr. Nussbaum Lan. A Graphing Lines Use the chart to determine the correct amino acid that this DNA would code for - ATA * 1 point GFL E D А Y STOP Alanine U Tyrosine C. STOP Stop V Valine GU Cysteine U Stop G Tryplophan R Arginine G А С U A Leucine S. K Serine A C L UGA Lysine Proline Аsparagine M START H. I R o search 99. Serine ThreonineIII. Deletion of C IV. Both I & II 6. Refer to the figure answer the following questions. CLUSTAL W (1.83) multiple sequence alignment Human_AA Oyster AA Corn_AA -MKLEWLLFTIGFCWAQYSSN--TOOGRTSIVHLFEWR-------WVDIALECERYLAPK 50 -QVILNCLLYVvGVVRGGTWSNPTCAPGRHTITHLFEWK- -WSDIAAECERFLGPM 52 MAKHLAAMCRCSLLVLVLLCLGSQLAQSOVLFOGFNWESWKKOGGWYNYLLGRVDDIAAT 60 : : : : *:*. %3: .. O Human_AA Oyster AA Corn AA GFGGVOVSPPNENVAIHNPFRPWWERYOPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYV 110 GYCGVOISPPNENRIVTSPNRFWWERYOPVSYKLVTRSGNEADLRDMVQRCNKVNVRIYA 112 GATHVWLPPPSHSVAPOGYMPGRLYDLD------ASKYGTHAELKSLTAAFHAKGVKCVA 114 ::*.. : ::.:. :.*: Human_AA Oyster AA Corn AA DAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDG-KCKTGSGDIENYNDA 169 DVVINHMTG-AGGSGTG-TGGSHWDGGSLSYPGVPFSSWDFNSGSECSTGDGNIHNYNDP 170 DVVINHRCA---DYKDGRGIYCVFEGG------TPDSRLDWGPDMICSDDTQYSN--GRG 163 :: * ***** Figure: Sequence alignment a) How many different species are used as the source of sequence in this analysis? I. two I. one II. three IV. four b) What…
- Word AaBbCcI AaBb CcD AaB AaBbCсI AaBbCcL 4 1 Normal Subtitle Title 1 No Spaci... Subtle Em..... Create and Share Adobe PDF Styles Adobe Acro P 1 1 2 4 A 3. A AL T L 4 E 5 E Question 6: The largest chromosome in Mischievous gremlinus has a length of 9 x 107 base pairs. The rate of DNA synthesis is 3,000 bp per minute at each replication fork. a. How long does it take to replicate the entire chromosome from a single origin of replication located exactly in the middle of the chromosome? Assume no pauses. I b. Experiments performed by Professor Trink reveal that it takes only 20 minutes for a growing cell to replicate this chromosome. What is the minimum number of replicons present on the chromosome? Florian Fischer Find v Replace Select Editing 153 23I want to know how can I make RNA transcript through next dna sequencing. 5'ATGATCTTTAAAGGGCCC 3'common-assessment-delivery/start/4797160920?action=onresume&submissionld%-468979669 English 9 Student D. S ddddddddddddddd... Type of Genetics Cr. S TEWWG Chapter DNA Protein Synthesis Test Chromosome Free Nucleotides DNA Polymerase Leading Strand Original- (Template DNA) Helicase Lagging Strand Replication Fork Adenine Thymine Guanine Cytosine DNA Polymerase Original (Template) DNA Strand 1. This diagram is showing the process of 2. 1f the original template strand reads: TTACGCAGT, DNA polymerase would add nucleotides in the order: 4 5 6 7 8. 9 10
- ersonal/eenongen_my_tnstate_edu/_layouts/15/doc.aspx?sourcedoc={a6b083c9-a226-4c31... ☆ Search (Option + Q) Review View Help Picture Editing A В ... During nucleic acid hybridization, the probe is labelled Question 1 options: for DNA stability to increase probe-test DNA binding to identify the location of probe and the test DNA binding for amplification Question 2 6. 9. 10 IV 13 14 Which of the following best describes the trait in the pedigree? Question 2 options: X-linked dominant X-linked recessive autosomal domiant autosomal recessive ONUgy Final Exam - Biology Final Exam - RELAX! - K1 x+ A learning.k12.com/d21/le/enhancedSequenceViewer/1433017?url=https%3A%2F%2Fe02711f5-1353-40b6-af9b-3497ff846bd.sequences.api.b Apps KI2 K12.com KI2 OLS Login O My Info K12 Customer Supp. Class Connect O LogMeln123 KI2 Microsoft Office 365 xfinity | Portal ( Back to Content Biology Final Exam Time Limit: 2:00:00 Time Left:1:25:28 Nizyree Dotson: Attempt 2 Question 9 (1 point) Which of these processes is not a type of reproduction? 7. 8 Sexual 10 11 12 Asexual 13 14 15 O Mitosis Metabolism 16 17 18 Question 10 (1 point) E A X C V B N MBio1B 3/23 DNA/Protein Syntl X S le festin song analysis | Schoo X G what compounds are re /common-assessment-delivery/start/4797160920?action%3Donresume&submissionld%3D468979669 Ai. English 9 Student D. S ddddddddddddddd... Type of Genetics Cr. S TEWWG Chap DNA Protein Synthesis Test DNA REPLICATION 1. The enzyme is responsible for unzipping the helix to start the process of replication. 2. is responsible for adding new nucleotides to the template strand during replication. 6 7 8 9 10 11 ment-delivery/start/47971609207action-onresume&submissionid-468979669# Support | Schoology Blog | PRIVACY PO
- 5 X O https://student.masteryconnect.com/?iv it41199tzPsQ_21hXG6OXABtokesw7jBW 912 Approved Sites SCS 21-22 SCI BIO District CFA2 Perez Jimenez, Dorian 00 4 of 20 The diagram shows the structure of DNA with complementary base pairing between strands. What is the benefit of this complementary nature of DNA? O It helps in controlling the amount of protein produced by the cells. O It helps in storing all the information required for the cell to function efficiently. It helps in the synthesizing of two new identical DNA strands from each parent strand O I t helps in the unwinding of DNA allowing for the formation of chromosomes during mitosis Type here to searchDNA Replication, Sequencing, and Recombination - PowerPoint Karla Henthorn KH Animations Slide Show Review View Help O Tell me what you want to do A A E. s et Direction- Align Text Shape Fill O Find US abs AV- Aa - ay. A- Stiape Outine- ab Replace- ne Arrange Quick Styles Convert to SmartArt Shape Effects A Se Font Paragraph Drawing 6 5 4 1 3 Ec 2 1 2 3 H4 Kim ACTIVITY Consider the following DNA molecule: ACG GTACACTTA C G A A Henthorn, ic T GCCAT GT GA ATG CT T Rc 1) Draw the 2 strands after they have "unzipped". 2) Follow the rules for pairing and fill in the new strands with the correct nitrogenous bases. Write these new strands in a different color of ink. = Notes Comments 可 DO DELL☆回 w Insert Format Tools Add-ons Help Last edit was yesterday at 8:08 AM TURN 100% Normal text Arial 11 BIUA E- 1E E E - E EX 2. 3 . 5. C Directions: Describe the process of DNA replication in the space below. Specifically reference the pictures in your answer. Your response will undergo a plagiarism check. Be sure to write your response in your own words. Be sure to reference and thoroughly explain: The relationship and importance of DNA replication and the cell cycle. The conservation of genetic information during replication. (Is it conservative? Semi-conservation? Dispersive? What does this mean?) The specific enzymes used in each step and indicate whether each of the enzymes is a synthesis reaction or a digestion reaction. Justify your answer through explanation. Identify the parameters and limitations of the enzymes working effectively. (What factors would limit or interfere with DNA replication?)