The strength of collagen comes from which of the following?   a. hydrophobic interactions and hydrogen bonds   b. crosslinking via peptide bonds   c. β sheets   d. crosslinking as a result of disulfide bonds

Q: In an active transport protein, ATP hydrolysis.causes the protein to change shape. ATP hydrolysis…

A: Channels (ion channels to be more specific) are a type of transport protein with just one gate.…

Q: 8. Which of the following fatty acids is most likely to be a liquid at room temperature? ОН -H OH OH…

A: Fatty acids are carboxylic acids with a hydrocarbon chain ranging from 4 to 36 carbons. In fatty…

Q: Draw a diagram to illustrate the locations of the omega (w), phi (p), and psi (4) rotational bond…

A: Omega (ω), phi (ϕ), and psi (ψ) angles are used to illustrate how atoms rotate along the polypeptide…

Q: 47.Describe the difference between a pyrimidine and a purine base?

A: DNA and RNA are the basic molecules that store and transmit genetic information in living organisms.…

Q: 55. what is the difference between the BIGpharma and biopharma

A: Biopharma and Big Pharma comprise the pharmaceutical industry. Biopharma develops biologics from…

Q: 6. A quantitative amino acid analysis reveals that bovine serum albumin (BSA) contains 0.58%…

A: Amino acids, such as glycine, tryptophan, and alanine are organic molecules that contain an amino…

Q: In patients with Lesch Nyhan Syndrome, purine nucleotides are overproduced and over excreted. The…

A: The body creates purines through de novo synthesis. Hypoxanthine-guanine phosphoribosyltransferase…

Q: 985. What does a microbial fuel cell consist of what can be found in these components?

A: Scientists and engineers are exploring microbial fuel cells (MFCs) for sustainable energy and waste…

Q: Which of the following functions describes the enzyme Peptidase? A. remove phosphate from a…

A: All living things depend on proteins in one way or another. The building components of peptides and…

Q: The pK₂ of the x-carboxyl group of serine is 2.21, and the pKa of its a-amino group is 9.15.…

A: pKa is the pH at which a weak acid is 50% dissociated. % ionisation of a weak acid = % ionisation of…

Q: The major lipid in the diet and in the body is sterols phospholipids triglycerides monosaccharides

A: Lipids are the organic components of the body which are made up of hydrogen, oxygen and carbon.…

Q: What is caffeine? what are the positive effects of caffeine? Why do teachers drink coffee, how does…

A: Plant secondary molecules are various groups of biomolecules produced by plants that give them…

Q: - Lactose is a sugar found in milk and other dairy products. Explain how it is broken down in most…

A: Since you have posted multiple questions, we will provide the solution only to the first question as…

Q: Question. Explain the signal transduction mechanism for slow ligand-gated ion channels.

A: Signal transduction mechanisms convert extracellular signals into many cellular responses,…

Q: Macm Determine the charge of the peptide at pH 5.5. -2 O -1 0 +1 +2 Determine the charge of the…

A: H        |H-N-C-COOH      |   |     H   HIn this structure, both the amino group of Glycine…

Q: Find the connection among the words below and choose the letter of the word which is different. O A.…

A: DNA fragment separation is accomplished using the agarose gel electrophoresis technique. It…

Q: Q. Provide two examples of the fate of a metabolite in the pathway

A: Metabolites' fates in pathways are fascinating stories of transformation and purpose in biochemical…

Q: Supposed you want to use phosphoglucomutase to breakdown glycogen. You found out that this enzyme is…

A: Protein-based biomolecules belong to the class of enzymes. They speed up chemical reactions. Enzymes…

Q: 55. State characteristics or demographics of persons affects with Alzheimer's disease?

A: The progressive neurological disorder Alzheimer's disease affects cognition, memory, and behavior.…

Q: PROTEINS 1. What will happen to free arginine after being subjected to biuret analysis (is it…

A: Proteins are large, complex biomolecules composed of multiple peptide-bonded amino acids. Proteins…

Q: List down 5 chemical properties of water that makes it an indispensable compound for life. Select…

A: Water is the solvent of terran life. The body of all lifeforms on earth is predominantly water,…

Q: The amino acid sequence of a small protein is MSRLASKNLIRSDHAGGLLQATYSAVSSIKNTMSFGAWSNAALNDSRDA.…

A: MHC (Major Histocompatibility Complex) are molecules responsible for presenting pathogenic peptides…

Q: Select the choice that best describes the stereochemistry of the following amino acid, and rank the…

A: Cysteine is one of the 20 standard amino acids that serve as the building blocks of proteins. It is…

Q: PROTEINS 1. What will happen to free tyrosine after being subjected to xanthoproteic analysis (is it…

A: Proteins are large, complex biomolecules composed of multiple peptide-bonded amino acids. Proteins…

Q: 1. In human beings, what is the major control of de novo pyrimidine nucleotide synthesis? A.…

A: Enzymes can be classified as biological catalysts. They enhance the rate of chemical reactions. This…

Q: presentation on the biochemical aspects of atherosclerosis(700 - 900 Words). Including the General…

A: Lipids, inflammatory cells, and extracellular matrix accumulate in the arterial wall in…

Q: 1. Analyze the following and identify which one mentions the function of a common eukaryotic ligase?…

A: Enzymes are protein-based biomolecules. They accelerate chemical reactions. They participate in a…

Q: D The peptide KNYPEH N-terminal amino group has a pKa of 8.6 and the C-terminal carboxylate group…

A: A peptide is a short chain of amino acid residues linked together via a peptide bond. Amino acid…

Q: Presentation about Atherosclerosis -molecular aspect -molecular effects -enzyme effect -general…

A: Introduction:Brief overview of atherosclerosis as a common cardiovascular disease.Importance of…

Q: OF THE 20 AMINO ACIDS, WHICH ARE CONSIDERED TO BE STRICTLY ACIDIC AND WHICH ARE BASIC?

A: Amino acids are the building blocks of proteins. They are organic compounds containing both an amino…

Q: 33. Describe how calcium functions as a second messenger.

A: Cellular signaling relies on second messenger calcium (Ca2+). Second messengers are small molecules…

Q: Which of the following molecules is richest in energy when metabolized? Glucose Linolenate, a fatty…

A: Glucose is the primary source of energy for the body. When there is no glucose available, the body…

Q: With respect to the following pairs of biomolecules which is produced via a mutarotation? D-Fructose…

A: An anomeric carbon in a sugar molecule can spontaneously switch between its and forms in a solution…

Q: Polypeptides contain two amino acids joined by peptide bonds four amino acids joined by peptide…

A: A peptide bond is a type of chemical bond that forms between the carboxyl group (-COOH) of one amino…

Q: Consider the following peptide: Lys-His-Asp-Glu-Phe-Cys-Ala-Asp-His-Arg What is the net charge of…

A: Amino acids are amphoteric. At a given pH, state of ionization of alpha-carboxylic acid group (pK1),…

Q: 28. Describe the role of an amplifier enzyme.

A: Enzymes are proteins that help in accelerating chemical reactions. An enzyme is called an amplifier…

Q: 42. WHAT DOES A MICROBIAL FUEL CELL CONSIST OF WHAT CAN BE FOUND IN THESE COMPONENTS?

A: A microbial fuel cell (MFC) is a bioelectrochemical device that utilizes microorganisms to convert…

Q: Estimate the apparent slope of the plot for myoglobin. myoglobin apparent slope = Estimate the…

A: The Hill plot is the graph we obtain by plotting   at X-axis and  at Y-axis. By looking at the value…

Q: the atoms in the compound. F arbon has an atomic weight of atoms x 1 = 12) + Oxygon ha

A: Molecular Formula of Starch C 6 H 10 O6. The molecular weight of Starch is 162.(72+10+80) = 162.

Q: Draw a diagram of a peptide bond in the cis and trans configurations. Show the contributing…

A: The amino group (NH2) of one amino acid and the carboxyl group (COOH) of another amino acid can join…

Q: The aspartate carbamoylase (ATCase) is an enzyme that catalyzes the reaction below utilizing the…

A: The scientific name for ATCase is aspartate transcarbamoylase. The enzyme is multimeric. It is made…

Q: What is the ratio [A]/[HA] at pH 2.75? The pKa of formic acid (methanoic acid, H-COOH) is 3.75. Draw…

A:

Q: 709. Explain the signal transduction mechanism for the phosphotidyl inositol second messenger system

A: The phosphatidylinositol (PI) second messenger system helps cells receive extracellular signals and…

Q: 18. What are erythrocytes ghost and how are they prepared

A: Erythrocyte ghosts, also known as membranes or "ghosts," are red blood cell membranes that remain…

Q: Which of the reactions are spontaneous (favorable)? L-malate + NAD+ oxaloacetate + NADH + H+ AG =…

A: Gibbs free energy change (ΔG) is a thermodynamic quantity that represents the maximum reversible…

Q: • The Predator's Mb has a higher affinity for O₂ than the Alien's Mb O True False

A: Ans- falseAs the myoglobin curve for Alien achieves P50 much before the predator, it means Mb of…

Q: A protein was purified and then analyzed on a size exclusion column. Its MW was determined to be…

A: SDS-PAGE (Sodium Dodecyl Sulfate Polyacrylamide Gel Electrophoresis) is used for separating proteins…

Q: Q. How to judge which amino acids are more hydrophobic vs hydrophilic?

A: The hydrophobicity and hydrophilicity of amino acids determine their biological behavior. These…

Q: Question 8 Elevated levels of acetyl-CoA will directly act as an effector for which of the following…

A: Acetyl CoA is an intermediate substance that connects Glycolysis and TCA cycle, which are the two…

Q: 23. Why does DMEM separate into two distinct pH phases in a liquid?

A: Biology and biomedicine use Dulbecco's Modified Eagle Medium (DMEM) for cell culture. It provides…

Tissue regeneration & repair

Tissue regeneration involves the restoration of tissue components by regrowth of damaged tissues. In contrast, tissue repair involves patching of injured tissue rather than restoring it. It is the proliferative capacity of the cells that decides the amount of regeneration against the repair that would occur in the tissue. Both regeneration and repair depending on the duration of the injury and response to the inflammation.