Using two centrifuges (A and B), with maximum speeds of 1500 rpm (r = 8 cm) and 3000 rpm (r = 8 cm), respectively, construct a separation scheme for separating three subcellular structures with the following xg requirements: • PAT – 150 xg • SAT – 120,000 xg • HAT – 650 xg
Q: How does pair pulse-facilitation demonstrate Hebb's postulate and why is it transient? (please…
A: When an action potential reaches the presynaptic terminal, it activates and opens voltage-gated…
Q: Cancer stem cells (CSCs) are cancer cells (found within tumors or hematological cancers) that…
A: Cancer is a condition in which cells proliferate abnormally and infiltrate, erode, and kill healthy…
Q: A protein was recently discovered to be located in the nucleus. However, it is uncertain whether…
A: The most important and basic knowledge that we should remember here in-order to understand the…
Q: What kind of systems have been developed to detect CSCs? Describe by giving examples.
A: CSCs are a little subpopulation of self-recharging harmful and oncogenic cells that are responsible…
Q: Question 1 of 10 Question 1. If you were to engineer some non- adhesive cells to express E-cadherin…
A: Cadherin helps in cell - cell adhesion. These adhesion molecule are calcium dependent.
Q: Cancer stem cells (CSCs) are cancer cells (found within tumors or hematological cancers) that…
A: Cancer stem cells like normal stem possess the ability of self renewal with one problem: the cell…
Q: . On the same graph, you should include the following two lines : i. Cell surface area on the…
A:
Q: (r = 8 cm), respectively, construct a separation scheme for separating three subcellular structures…
A: Centrifuges are devices used to separate components dissolved in a fluid. They are used to separate…
Q: Name conditions caused by abnormalities of vertical linkages and horizontal (lateral) linkages in…
A: Deformation of the membrane: During RBC deformation, specttrin dimer linkages that emerge along the…
Q: What could be an example of in vitro experiment to identify cytoskeleton accessory proteins?
A: Cytoskeleton is the part of a cell which provides structural support to the cell and plays roles in…
Q: What is shrinkage state ?
A: To describe: To describe shrinkage state and the process involved in it.
Q: Name two main steps which are collectively referred to as down streaming process. Why is this…
A: Downstream processing is a major step in the mass production of biosynthetic products. It is carried…
Q: you wanted to test the effect of a 1:500 dilution (500-fold) of coffee on PtK2 cells, how much of a…
A: The formula for calculating a dilution is (C1) (V1) = (C2) (V2) whereC1 is the concentration of the…
Q: ibin
A: Prescribing the medications for treatment is the primary function of a doctor which has expanded to…
Q: What is the molecular mechanism that retains SCAP–SREBP in the ER when cholesterol is present but…
A: The complex of SCAP and SREBPs migrates to the Golgi complex when "sterol levels decline not when…
Q: Blood of density 1,060 kg/m3 and viscosity 0.0034 Pa/s flows through an aorta with radius 0.013 m.…
A:
Q: Cancer stem cells
A: Cancer stem cells (CSC) represent malignant cell subsets in hierarchically organized tumors, which…
Q: How sar-coplasm increases. Explain
A: The skeletal muscles help in regulating body temperature and release the heat from the muscles.…
Q: Assume you have the factors in hand necessary to reprogram an adult cell, and the factors necessary…
A: The stem cells are an undifferentiated mass of cells used to treat damaged tissues. It is studied…
Q: Design a diagnostic test kit based on bio-sensor principles, for COVID-19. (Specify the main…
A: Introduction :- Covid-19 is a very contagious infection ( disease) caused by the SARS-CoV-2. It…
Q: What functional assays did Kazutoshi Takahasi and Shinya Yamanaka use to show that induced…
A: Kazutoshi Takahashi and Shinya Yamanaka modified mouse fibroblast cells that are able to synthesize…
Q: Explain how the specializations for M-phase function prevents the activities of Interphase,…
A: The cell cycle starts with resting (G0) phase. Then proceeding to interphase (G1 phase, S phase, G2…
Q: Unfolded proteins in the lumen of the endoplasmic reticulum are directly detected by which protein?…
A: The endoplasmic reticulum is in continuation of the nuclear membrane in a cell. It plays a very…
Q: the needed materials/molecules of Mitotic checkpoint?
A: CELL CYCLE:- When a cell is to divide, it is expected to synthesize its various components including…
Q: Which protein in the human erythrocyte is properly categorized as a transmembrane protein?…
A:
Q: Were you able to identify a cell undergoing cytokinesis in the onion cell? Why? What extra layer…
A: Cell division is defined as the division of the cells for growth, repair and reproduction. Cell…
Q: What kinds of cells are shown here? Explain what causes the colorsand appearance of the stages you…
A: This is a rod shaped bacteria and hence bacillus subtilis. Which is stained along with the bacterial…
Q: Propidium iodide (PI) can be used to study both cell division and apoptosis using flow cytometry.…
A: Propidium iodide (PI) is a popular red-fluorescent dye that can be used to stain cells and nucleic…
Q: Explain How is the gradient generated?
A: The electrochemical proton gradient is a concentration and electrical potential gradient caused by a…
Q: Anaphase B involves the separation of spindle poles. What forces have been proposed to drive this…
A: Anaphase is the third stage, followed by metaphase that is characterized by the seperation of…
Q: Three polypeptides, the sequences of which are represented below using the one-letter code for their…
A: In peptide 1, - (ATKNRASCLVPKHGALMFWRHKQLVSDPILQKRQHILVCRNAAG) Total number of negatively charged…
Q: Select true or false for each of the following statements regarding prophase II. Synapsis and…
A: Meiosis is a special type of cell division that reduces the chromosome number by half, creating four…
Q: While they are similar in many ways, some key differences occur late in the mitotic division.…
A: Mitosis is a phase of the cell cycle during which replicated chromosomes are split into two new…
Q: Cancer stem cells (CSCs) are cancer cells (found within tumors or hematological cancers) that…
A: Cancer is a disease in which cells multiply abnormally, infiltrating, eroding, and killing healthy…
Q: Describe why it is important to calculate the absolute number when performing a differential cell…
A: Differential cell count is used to analyze the relative percentage of each type(neutrophils,…
Q: What is one manner in which ERAD may identify misfolded proteins? Why is dislocation of these…
A: Proteins are the essential biomolecules that play a diverse role. Almost all cellular activities are…
Q: Models of higher-order compaction suggest that thenucleosomal fiber is _____ into a shorter but…
A: DNA packaging is done in order to fit the linear DNA molecule inside the nucleus. Is starts when DNA…
Q: Why do we utilize micropipettes when dispensing volumes in cell/molecular biology labs? a They are…
A: Biology is a branch of science. Bio means life and ology means study. Biology is basically the study…
Q: What are the needed materials/molecules of Intra S-phase checkpoint?
A: DNA replication takes place more actively in the S phase of the cell cycle which occurs in between…
Q: In adult cells that have stopped dividing, what types ofrepair systems are possible?
A: DNA repair mechanisms remove the errors from DNA and maintain the integrity of the genetic…
Q: Please answer asap 15) Which molecular tag selects cargo proteins for lysosome. What molecular tag…
A: In many animal cells, a lysosome is a membrane-bound organelle. They're spherical vesicles with…
Q: Compare and contrast GPCRs with RTK. Please keep brief - 10 sentences/dot points max.
A: The difference between GPCR and RTK are: G-protein coupled Receptors Receptor Tyrosine Kinases…
Q: Which region on the following Ramachandran Plot corresponds to the allowable region(s) for Pro? J…
A: The Ramachandran plot is a plot between the torsional angles of the amino acids in a peptide. The…
Q: Cancer stem cells (CSCs) are cancer cells (found within tumors or hematological cancers) that…
A: Regular stem cells like hematopoietic stem cells that give birth to the entire blood cell lineages…
Q: calculate E ° cell for the voltaic cell described, which is based on the reactionCr2O7 2-1aq2 + 14…
A: The cell potential, Ecell, is the proportion of the possible distinction between two half cells in…
Q: Is the device suitable for screening for breast cancer, based on your calculated values of its…
A: Patient: Positive for the disease (P) Healthy: Negative for the disease (H) True positive: Number of…
Q: Describe the main types of large-scale structural changes inchromosomes, and explain their potential…
A: A mutation occurs when the nucleotide sequence of a gene or chromosome changes. It can be…
Q: A cell stops proliferating when treated with a chemical analog to fucoxanthin. When these cells are…
A: Cell proliferation refers to the growth and division of cells. The cell division by which the…
Q: You need linear-linear paper and log-linear paper (also called semi-log paper), for linear-linear,10…
A: Cell density can be defined as the number of viable cells present in a unit volume. It can be…
Using two centrifuges (A and B), with maximum
speeds of 1500 rpm (r = 8 cm) and 3000 rpm
(r = 8 cm), respectively, construct a separation
scheme for separating three subcellular structures
with the following xg requirements:
• PAT – 150 xg
• SAT – 120,000 xg
• HAT – 650 xg
Step by step
Solved in 2 steps
- Using two centrifuges (A and B), with maximum speeds of 1500 rpm (r = 8 cm) and 3000 rpm (r = 8 cm), respectively, construct a separation scheme for separating three subcellular structures with the following xg requirements: PAT – 150 xg - SAT – 120,000 xg НАТ - 650 хgFor this exercise, an electron micrograph of secretory cells of the anterior pituitary is being used (Sandborn, E.B. (1970) Cells and Tissues by Light and Electron Microscopy, New York, New York: Academic Press, Inc.). The image originally measured 18.7 cm wide and 18.5 cm high with a magnification of 5200x. Given the width of the original micrograph at 18.7cm, what is the true width of unmagnified image? Show calculations.A sample of a protein is analyzed by CE using a neutral-coated capillary with a total length of 25.0 cm and a distance to the detector of 22.0 cm. Using an applied voltage of 20.0 kV, the protein was detected at a migration time of 16.2 min. The diffusion coefficient for the protein is 2.4 x 10-7 cm?/s. (a) Calculate the apparent electrophoretic mobility of the protein. (b) Calculate the expected number of theoretical plates for the analysis.
- Electrophoretic flow and electroosmotic flow (EOF) plays an important role in capillary electrophoresis (CE) for ions movement. Explain the differences between electrophoretic flow and EOF. b) Suggest two different approaches (other than reducing the voltage) to reduce the electroosmotic flow. c) Three water soluble vitamins: niacinamide (a neutral compound), riboflavin (a neutral compound) and thiamine (a cation) were separated by micellar electrokinetic capillary chromatography (MEKC) in 15 mM borate buffer (pH 8) with 50 mM sodium dodecyl sulfate. The migration times were niacinamide (7.5 min), riboflavin (12.8 min) and thiamine (13.9 min) Explain why these vitamins were separated using MEKC. Explain why niacinamide and riboflavin (both are neutral compounds) have different migration times. (i) With the aid of a diagram, differentiate flow profile of electroosmotic flow (EOF) and laminar flow. (ii) Discuss the effect of both flows in term of peak resolution.Q1/ For the circuit shown in Fig. 1, find the admittance Yr in both polar and rectangular forms. (10 Marks) 10 R34 R₁ 201 XL 000 1512 Fig. 1 Ry 16 fCancer stem cells (CSCs) are cancer cells (found within tumors or hematological cancers) that possess characteristics associated with normal stem cells, specifically the ability to give rise to all cell types found in a particular cancer sample. There are many biomedical engineering based approaches to detect CSCs. 1) What is the importance and advanatge of detecting CSCs? 2) What kind of systems have been developed to detect CSCs? Describe by giving examples.
- In this problem, you will design a filter system for a flow cytometer. The four fluorescent dyes are FITC,PE, PE-TR,and PE-Cy5. Their emisison spectra are provided below. Detectors are arranged as shown in thefigure below. The FITC signal is detected from Filter 1, the PE signal from Filter 2, the PE-TR signal fromFilter 3 and the PE-Cy 5 signal from Filter 4. Part 4.1Provide a rationale for the order in which the filters are arranged with respect to the unfiltered signal. Part 4.2You are given 9 candidates from which you have to choose 4 for the filters in the diagram above. Choose4 and justify your selection.# Filter type WavelengthA Long pass 650 nmB Short pass 530 nmC Long pass 490 nmD Band pass 550-590 nmE Long pass 560 nmF Short pass 640 nmG Long pass 620 nmH Band pass 620-640 nmI Short pass 590 nmA new 850 cm^2 membrane is being tested for use in a hemodialysis device. During testing, a model fluid mixture is used that contains solutes with average radii of 1 nm. In one test, the concentration of the filtrate is found to be 2.17 g/L, while the concentration on the feed-side surface is 8.52 g/L. Prior experimentation showed that the mass transfer coefficient in the device was approximately 9 × 10-4 cm/s. A) If the total filtration flow rate is measured to be 0.56 cm^3/s, what is the solute concentration in the feed solution? B) Explain how you could determine the average membrane pore radius for this membrane using this information.Cancer stem cells (CSCs) are cancer cells (found within tumors or hematological cancers) that possess characteristics associated with normal stem cells, specifically the ability to give rise to all cell types found in a particular cancer sample. There are many biomedical engineering based approaches to detect CSCs. 1) What is the importance and advanatge of detecting CSCs? 2) What kind of systems have been developed to detect CSCs? Describe by giving examples. Please explain in detail with your own words.
- Synaptic vesicles release into the synapse to give the message to the post synaptic neuron?Multicellular organisms:a) are larger in size than unicellular organisms b) can do a wider variety of functionsFor a stroke patient with hypertension who is a candidate for recombinant tissue plasminogen activator rt pa which blood pressure control strategy is appropriate?r^2=6Dt , where D is the diffusion coefficient of thediffusing object and t is the time that the object is allowed to diffuse. If the diffusion coefficient, D, of a small protein is 5 x 10^-10 m2 s-1, how long (on average) does ittake for the protein to diffuse across a parasitic wasp that is 189 um long ?Cancer stem cells (CSCs) are cancer cells (found within tumors or hematological cancers) that possess characteristics associated with normal stem cells, specifically the ability to give rise to all cell types found in a particular cancer sample. There are many biomedical engineering based approaches to detect CSCs. Question: What is the importance and advanatge of detecting CSCs? Please explain in detail
