Drag the term or statement to the correct column. Molecular Mechanism Change Cis or trans Acetylation, phosphorylation, and methylation Covalent addition to DNA Methylation on C Cis Histone variants localized to specific locations Chromatin remodeling Histone varlants localized to specific locations Cis
Q: Give at least one example of a chromosomal structureor function affected by the following mechanisms…
A: Chromosomes are thread-like structure of nucleic acids and protein, which are found in the nucleus…
Q: Voca geneticist dna genetic counselor karyotype cystic fibrosis mutation pedigree sickle cell…
A: Introduction :- A chromosome is a lengthy DNA molecule that contains part or all of an organism's…
Q: Answer the following: DNA fragment A is 3' AGC CCG CTC CGA GGC TAA AAG CGT 5' 1. is % of guanine…
A: The central dogma of life is that DNA self replicates to form its own copies. The copied DNA is…
Q: Which of the following types of epigenetic changes may promote cancer?a. DNA methylationb. Covalent…
A: Epigenetics represents one of the merging fields of biology concerned with the study of heritable…
Q: True or False. De-acetylation of histone tails allows nucleosomes to pack together into tighter…
A: DNA is the nucleic acids present in the organisms. DNA is the deoxy ribose nucleic acid in which…
Q: The following is the sequence on one of a DNA molecule A A T G C C A G T G G T 1. If this strand is…
A: “Since you have posted a question with multiple sub-parts, we will solve first three sub parts for…
Q: The gene encoding the protein/enzyme: a) DNA ligase b) the B clamp c) primase
A: DNA ligase binds two formed DNA pieces and hence is not the answer to this question. Primase is the…
Q: In a nucleosome, the DNA is wrapped around ribosomes a thymine dimer polymerase molecules histones
A: Nucleosome Nucleosome is a segment of DNA that wrapped around a protein core.
Q: compare how histones and micro RNA control gene expression.
A: A gene is an essential unit of heredity and a succession of nucleotides in DNA or RNA that encodes…
Q: Which statement is FALSE? Group of answer choices Histones are very conserved at the primary…
A: 2nd statementis false. H1 doesn't contain histone fold domain. H2A, H2B, H3 and H4 have HFD
Q: Explain the steps in Histone Modification in the process of Phosphorylation. Take note, important…
A: Histones are proteins that associate with DNA to help in the condensation into chromatin. They are…
Q: The map of the chromosome which shows identifiable sites is called___________a) Gene expressionb)…
A: Chromosomes can be defined as thread-like structures where the DNA remains tightly packed within the…
Q: A protein uses a gene template in 3' to 5' direction. What are the amino acid sequences following…
A: The protein is synthesized from mRNA by the process of translation. It takes place in cytoplasm of…
Q: DNA forms a thick fiber that is formed into structural loops. This formation is associated with... O…
A: Introduction: DNA stands for the deoxyribonucleic acid. It is a biomolecule that is composed of two…
Q: Write TRUE or FALSE. If false, write the word/s that make(s) the statement incorrect. 1.Telomeres…
A: DNA is the genetic material that exists in every cell in your body . This DNA is wrapped up with the…
Q: Short DNA sequence having single occurrence in genome isa) Expressed sequence tagb) Sequence tagged…
A: DNA is the genetic material present in most of the living organisms. The DNA is made up of 4…
Q: Not make to copy or incorrectly do. Else downvote.
A: We know that Genotype is defined as the genetic makeup of an individual organism and it is the sum…
Q: Fill in the blanks (NO PARAGRAPHS ONLY SHORT ANSWERS) Normal DNA: TGC GTG CTT AAG CGG TGT…
A: m RNA of the normal DNA will be:- ACG CAC GAA UUC GCC ACA UGU GCA ACG Amino acid coded will be (in…
Q: В. Draw lines to match up the beginning and the end of the sentences relating to chromosomes, genes…
A: DNA is the genetic material in living organisms that is made up of nucleotides. Nucleotides are the…
Q: cleotides nucleus adenine cytosine…
A: The process in which DNA forms RNA is called transcription and the process in which RNA forms…
Q: A single enzyme’s production is specified by a single Select one: a. histone b. gene c.…
A: One gene-one enzyme hypothesis states that the function of a gene is to dictate the production of a…
Q: Which one is correct about telomeres? Choose at least one correct answer TTAGGG sequence is…
A: The distinctive structures that are found at the ends of our chromosomes and consist of the…
Q: A frameshift is caused by ________ mutations.
A: Frameshift mutation is a genetic mutation caused by deletion or insertion in a DNA sequence that…
Q: View the given linked video to see the detailed structure of the different kinds of DNA. After…
A: DNA is the basic genetic unit of many organisms. DNA is a nucleic acid which content genetic…
Q: In nucleosomes, DNA wrapped around octamar of histone proteins O False True
A: A histone octamer is the eight protein complex found at the focal point of a nucleosome center…
Q: Match the definition on the left with the term on the right Tightly hypercolled DNA that is not in…
A: The DNA is the genetic material in human that is present within the nucleus of a cell. This DNA…
Q: Basic pRotein coding gene steucture: TF'S ENA-Pol TSS genomic DNA PROmoteRlexon ATG intreon exon…
A: By the process of transcription mRNA is produced from the DNA. This process occurs within the…
Q: The structural unit of the eukaryotic genome is called a(n): a. nucleosome b. histone c. chromatin…
A: The genome of a eukaryote is composed of DNA and histone proteins.
Q: structure of DNA from the level of a gene to a condensed mitotic chromosome. At each of the four…
A: Gene expression is the process in which transcription is followed by translation. In transcription…
Q: Protein Synthesis genetic code DNA MRNA protein trait DNA contains the of lifel transcription…
A: DNA stands for deoxyribonucleic acid. It is present in the nucleus of the cell
Q: tight packing of previously less condensed chromatin identify which describes the statement…
A: Post translational modifications in histone proteins can change the shape of chromatin, which can…
Q: Enumerate and define the steps/processes involved in replication.
A: Replication is the process in which two identical copies of DNA molecules are produced from the…
Q: Viruses that infect bacteria (bacteriophage) sometimes encode a lysozyme gene in their genome. The…
A: Bacteriophage is one type of virus which infects bacterial cell and destroy it. Bacteriophage…
Q: Duchenne Muscular Dystrophy (DMD) is a disease that manifests in muscle weakness. It exhibits…
A: The mutation is the change in the nucleotide sequence that codes for the phenotype in an organism.…
Q: Which illustration below correctly depicts the effect of histone modification in chromatin…
A: The power of ATP is used by chromatin remodelers to move DNA around nucleosomes. Remodeler…
Q: asic amino acids including lysine. DNA and histones collectively form chromatin. Open open and…
A: Histones can be defined as the family of basic proteins that are associated with the DNA in the…
Q: In a nucleosome (histone-DNA structure), the histone is highly positively charged. True O False
A: A nucleosome can be described as the section of DNA which is wrapped around the core of proteins. It…
Q: Which region of chromatin is transcriptionally silent?a) Nucleoidb) Centromerec) Euchromatind)…
A: Deoxyribonucleic acid (DNA) is a molecule composed of two polynucleotide chains. It coils around…
Q: Describe the major steps involved in gene transcription. This answer must not exceed 1200 words.…
A: Answer: Introduction: Prokaryotic gene expression is regulated by two processes i.e. transcription…
Q: Complete each sentence with the appropriate term or phrase. (Each box can be used only once, and not…
A:
Q: Choose the BEST answers: Transcription begins whe✔ Choose... gene and u DNA polymerase Choose...…
A: When an enzyme known as RNA Polymerase (RNA pol) binds to the template DNA strand and starts to…
Q: Jsing the picture below determine the type of mutation that has occurred. Mutated Chromosome
A: Any abrupt alteration in the nucleotide sequence of genes is defined as a mutation. It can also be…
Q: Acetylation is the addition of acetyl groups to DNA and histones Deacetylation will loosen the…
A: 1. addition of acetyl group 2. demethylation will loosen the association of DNA with histones 3.…
Q: Decide whether the statement is TRUE OR FALSE. Justify your answer. Introns are coding regions of…
A: Gene and gene expression genes are the heredity units present on the chromosomes which further…
Q: Define the following terms: a. histone b. heterochromatin c. spermine d. intergenic sequences e.…
A: DNA is packaged into the cell nucleus after packaging into nucleosomes. The DNA contains regions of…
Q: The steps that involve complementary base pairing is the second step in which the nucleotide is…
A: 1. DNA replication is the process by which two identical copies of the DNA template strand is…
Q: 2 3 3' 5' ATGACGGATC UACUGCCUAGUC 5 SCAAGCGGAATTGGCGACATAA GCGUU 3…
A: Genetic information is transferred from DNA to the proteins via RNA by the process of transcription…
Q: Parent strand DNA: 5-AGA-ACT-AAA-СТА-ТCG-CT-CGT-3 DNA daughter strand: hnRNA: MRNA: original…
A: Replication occurs in a bidirectional manner. Always happens in the 5'→3' direction because…
Q: Consider the following segment of DNA, which is part of a linear chromosome: LEFT…
A: RNA transcription is a process where double-stranded DNA is transcribed into mRNA. This mRNA is…
Genetics Question about epigenetic mechanisms. This is the only question that I just do not understand. Which column does each of these go in and they can used multiple times or not at all.
Trending now
This is a popular solution!
Step by step
Solved in 2 steps
- Mutated DNA Sequence #2 T A C G A C C T T G G C G A C G A C T … What’s the mRNA sequence? (Circle the change) What will be the amino acid sequence? Will there likely be effects? What type of mutation is this? ________________________________Mutated DNA Sequence #3 T A C A C C T T A G C G A C G A C T … What’s the mRNA sequence? (Circle the change) What will be the amino acid sequence? Will there likely be effects? What type of mutation is this? ________________________________ Mutated DNA Sequence #4 T A C A C C T T G G C G A C T A C T … What’s the mRNA sequence? (Circle the change) What will be the amino acid sequence? Will there likely be effects? What type of mutation is this? ______________________________Sickle cell hemoglobin DNA CACGTAGACTGAGG ACAC.. Sickle cell hemoglobin MRNA Sickle cell hemoglobin AA sequence 4. What type of mutation is this? Please explain why.
- III. Deletion of C IV. Both I & II 6. Refer to the figure answer the following questions. CLUSTAL W (1.83) multiple sequence alignment Human_AA Oyster AA Corn_AA -MKLEWLLFTIGFCWAQYSSN--TOOGRTSIVHLFEWR-------WVDIALECERYLAPK 50 -QVILNCLLYVvGVVRGGTWSNPTCAPGRHTITHLFEWK- -WSDIAAECERFLGPM 52 MAKHLAAMCRCSLLVLVLLCLGSQLAQSOVLFOGFNWESWKKOGGWYNYLLGRVDDIAAT 60 : : : : *:*. %3: .. O Human_AA Oyster AA Corn AA GFGGVOVSPPNENVAIHNPFRPWWERYOPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYV 110 GYCGVOISPPNENRIVTSPNRFWWERYOPVSYKLVTRSGNEADLRDMVQRCNKVNVRIYA 112 GATHVWLPPPSHSVAPOGYMPGRLYDLD------ASKYGTHAELKSLTAAFHAKGVKCVA 114 ::*.. : ::.:. :.*: Human_AA Oyster AA Corn AA DAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDG-KCKTGSGDIENYNDA 169 DVVINHMTG-AGGSGTG-TGGSHWDGGSLSYPGVPFSSWDFNSGSECSTGDGNIHNYNDP 170 DVVINHRCA---DYKDGRGIYCVFEGG------TPDSRLDWGPDMICSDDTQYSN--GRG 163 :: * ***** Figure: Sequence alignment a) How many different species are used as the source of sequence in this analysis? I. two I. one II. three IV. four b) What…Hello, I would really appiarte help appreciate help. This is a blank question so I am unsure why it was rejected immeditely the first time. Thank you in advance. Identify the type of mutation and how it would affect the protein made (amino acid) if the following changes occurred in the DNA antisense strand First codon change from TAC to TAT. Third codon change from ACG to ACA. Ninth nucleotide changes from G to T. Nucleotide with adenine (A) base inserted between 3rd and 4th nucleotide. Types of Mutation Changes in the Amino Acid 1. 2. 3. 4.BM4_DNA AND PROTEIN S X /1FAIPQLSDP_g5B-629FSHNpGnTMIEppLS4A71zBd4vcUBqNUILubXONw/formResponse 4. What is the nitrogen base pair of Adenine in transcription? O Cytosine O Uracil O guanine O thymine 5. The central dogma of Molecular Biology states that There are four nitrogen bases in DNA, two purines (adenine and guanine) and two pyrimidines (cytosine and thymine). Which process is not included in the central dogma? duplication transcription translation O translocation Leadple
- Question: Hi, can someone help me with this question thanks in advance. Select one of the following genetic diseases that appear in the following list:galactosemiacystic fibrosisDown's Syndromefamilial hypercholesterolemiamuscle gystrophyHuntington's diseasesickle cell anemiahemophiliaTay-Sachs diseasedescribe a composition about how the selected condition is generated. Include details about the number of people who report the disease, symptoms, treatments, among other aspects that you consider important. thanksFrom the mRNA base sequence CUU-AUG-GCU-UGG-CCC-UAA A.What anticodon sequences of tRNA’s are coded? B.What was the base sequence in the original DNA strand was made? Please answer completely will give rating surely Both questions answers neededDrag the term or statement to the correct column. Transcription factor stimulates own production Nucleosomes moved to new location Histone variants localized to specific locations Acetylation, phosphorylation, and methylation Cis Methylation on C Trans Molecular Mechanism Covalent addition to DNA Chromatin remodeling Covalent addition to histone Localization of histone variant Feedback loop Reset Change Cis or trans
- Please explain this in the lenth of 1 page or close please 1.How is the genetic code of DNA translated in specific protein moleculeswrite a correct terminology/word on column B that meet the description of column A COLUMN A COLUMN B 1. The site for protein synthesis where mRNA and tRNA meets. 2. Benign tumours or warts that might cause problems but do not spread to oyher parts of the body. 3. A nucleotide sequence that is complimentary to the mRNA codon. 4. A condition that depicts injury or diseased state of liver. 5. Term used to describe a process or condition which affects the general body function. 6. A type of virus that attacks the respiratory system to cause flue 7. The fluid found within the cell 8. A condition which describes harm, damage or impairment of kidney function. 9. To spilt a molecule or chemical bond. 10. The protein coat or shell of a virusOriginal DNA DNA Protein TACGCTATGAGC Methionine-Arginine-Tyrosine-Serine Mutation #1 DNA What type of mutation occurred? substitution insertion duplication deletion TACTCTATGAGC